Lineage for d2j2tg_ (2j2t G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974383Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2974407Protein automated matches [190353] (3 species)
    not a true protein
  7. 2974408Species Enterococcus faecalis [311217] (1 PDB entry)
  8. 2974415Domain d2j2tg_: 2j2t G: [304100]
    Other proteins in same PDB: d2j2td2
    automated match to d2jerd_

Details for d2j2tg_

PDB Entry: 2j2t (more details), 1.65 Å

PDB Description: agmatine deiminase from enterococcus faecalis covalently linked with a reaction intermediate
PDB Compounds: (G:) agmatine deiminase

SCOPe Domain Sequences for d2j2tg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j2tg_ d.126.1.6 (G:) automated matches {Enterococcus faecalis}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendhlaleqvqtmfpdkkivgvntvevvygggnihcitqq
epkrvg

SCOPe Domain Coordinates for d2j2tg_:

Click to download the PDB-style file with coordinates for d2j2tg_.
(The format of our PDB-style files is described here.)

Timeline for d2j2tg_: