SCOPe 2.06: Domain d2j2tc_: 2j2t C:

Lineage for d2j2tc_ (2j2t C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein automated matches [190353] (2 species)
   not a true protein

7. Species Enterococcus faecalis [311217] (1 PDB entry)

8. Domain d2j2tc_: 2j2t C: [304096]
   automated match to d2jerd_

Details for d2j2tc_

PDB Entry: 2j2t, 1.65 Å

PDB Description: agmatine deiminase from enterococcus faecalis covalently linked with a reaction intermediate

PDB Compounds: (C:) agmatine deiminase

SCOPe Domain Sequences for d2j2tc_:

Sequence; same for both SEQRES and ATOM records:

>d2j2tc_ d.126.1.6 (C:) automated matches {Enterococcus faecalis}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendhlaleqvqtmfpdkkivgvntvevvygggnihxitqq
epkrvgg

Timeline for d2j2tc_:

• d2j2tc_ is new in SCOPe 2.06-stable
  
• d2j2tc_ appears in SCOPe 2.07
  
• d2j2tc_ appears in the current release, SCOPe 2.08