![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
![]() | Superfamily d.126.1: Pentein [55909] (8 families) ![]() |
![]() | Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins) Pfam PF04371; functionally related to the amidinotransferase, similar active site |
![]() | Protein automated matches [190353] (3 species) not a true protein |
![]() | Species Enterococcus faecalis [311217] (1 PDB entry) |
![]() | Domain d2j2tb_: 2j2t B: [304095] Other proteins in same PDB: d2j2td2 automated match to d2jerd_ |
PDB Entry: 2j2t (more details), 1.65 Å
SCOPe Domain Sequences for d2j2tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j2tb_ d.126.1.6 (B:) automated matches {Enterococcus faecalis} akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici asymnflitndgvivpqygdendhlaleqvqtmfpdkkivgvntvevvygggnihcitqq epkr
Timeline for d2j2tb_: