Lineage for d2j0ca_ (2j0c A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005397Protein Mammalian cytochrome P450 3a4 [109958] (1 species)
  7. 2005398Species Human (Homo sapiens) [TaxId:9606] [109959] (7 PDB entries)
    Uniprot P08684
  8. 2005405Domain d2j0ca_: 2j0c A: [304090]
    automated match to d1w0fa_
    complexed with hem, ktn

Details for d2j0ca_

PDB Entry: 2j0c (more details), 2.8 Å

PDB Description: crystal structure of human p450 3a4 in complex with ketoconazole
PDB Compounds: (A:) cytochrome p450 3a4

SCOPe Domain Sequences for d2j0ca_:

Sequence, based on SEQRES records: (download)

>d2j0ca_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]}
hglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpdm
iktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpii
aqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventkk
llrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledtqkhrv
dflqlmidsqnsketeshkalsdlelvaqsiififagyettssvlsfimyelathpdvqq
klqeeidavlpnkapptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfip
kgvvvmipsyalhrdpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfal
mnmklalirvlqnfsfkpcketqiplklslggllqpekpvvlkvesrdg

Sequence, based on observed residues (ATOM records): (download)

>d2j0ca_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]}
hglfkklgipgptplpflgnilsyhkgfcmfdmechkkygkvwgfydgqqpvlaitdpdm
iktvlvkecysvftnrrpfgpvgfmksaisiaedeewkrlrsllsptftsgklkemvpii
aqygdvlvrnlrreaetgkpvtlkdvfgaysmdvitstsfgvnidslnnpqdpfventkk
llrfdfldpfflsitvfpflipilevlnicvfprevtnflrksvkrmkesrledvdflql
midsqalsdlelvaqsiififagyettssvlsfimyelathpdvqqklqeeidavlpnka
pptydtvlqmeyldmvvnetlrlfpiamrlervckkdveingmfipkgvvvmipsyalhr
dpkywtepekflperfskknkdnidpyiytpfgsgprncigmrfalmnmklalirvlqnf
sfkpcketqiplklslggllqpekpvvlkvesrdg

SCOPe Domain Coordinates for d2j0ca_:

Click to download the PDB-style file with coordinates for d2j0ca_.
(The format of our PDB-style files is described here.)

Timeline for d2j0ca_:

  • d2j0ca_ is new in SCOPe 2.06-stable