SCOPe 2.08: Domain d2in1b_: 2in1 B:

Lineage for d2in1b_ (2in1 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.4: UFC1-like [143072] (2 proteins)
   automatically mapped to Pfam PF08694

6. Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
   aka cgi-126

7. Species Human (Homo sapiens) [TaxId:9606] [143074] (7 PDB entries)
   Uniprot Q9Y3C8 1-167

8. Domain d2in1b_: 2in1 B: [304071]
   automated match to d2k07a_

Details for d2in1b_

PDB Entry: 2in1, 2.7 Å

PDB Description: Crystal Structure of the Human Ubiquitin fold conjugating enzyme 1 (Ufc1), Northeast Structural Genomics Target HR41

PDB Compounds: (B:) Ufm1-conjugating enzyme 1

SCOPe Domain Sequences for d2in1b_:

Sequence; same for both SEQRES and ATOM records:

>d2in1b_ d.20.1.4 (B:) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
deatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkeg
trwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfk
plwarnvpkfglahlmalglgpwlaveipdliqkgviqhkek

Timeline for d2in1b_:

• d2in1b_ first appeared in SCOPe 2.06
  
• d2in1b_ appears in SCOPe 2.07