Lineage for d1h81a1 (1h81 A:5-293,A:406-463)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 239501Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 239502Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 239553Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (10 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 239643Protein Polyamine oxidase [51927] (1 species)
  7. 239644Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries)
  8. 239663Domain d1h81a1: 1h81 A:5-293,A:406-463 [30407]
    Other proteins in same PDB: d1h81a2, d1h81b2, d1h81c2

Details for d1h81a1

PDB Entry: 1h81 (more details), 2.1 Å

PDB Description: structure of polyamine oxidase in the reduced state

SCOP Domain Sequences for d1h81a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h81a1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays)}
prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey
dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmc

SCOP Domain Coordinates for d1h81a1:

Click to download the PDB-style file with coordinates for d1h81a1.
(The format of our PDB-style files is described here.)

Timeline for d1h81a1: