Lineage for d2ijpb_ (2ijp B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007221Protein 14-3-3 protein cgd1_2980 [158770] (1 species)
  7. 2007222Species Cryptosporidium parvum [TaxId:5807] [158771] (2 PDB entries)
    Uniprot Q5CSF3 25-247
  8. 2007228Domain d2ijpb_: 2ijp B: [304069]
    automated match to d3efza1
    complexed with edo, unx

Details for d2ijpb_

PDB Entry: 2ijp (more details), 2.14 Å

PDB Description: Crystal structure of a 14-3-3 protein from Cryptosporidium parvum (cgd1_2980)
PDB Compounds: (B:) 14-3-3 protein

SCOPe Domain Sequences for d2ijpb_:

Sequence, based on SEQRES records: (download)

>d2ijpb_ a.118.7.1 (B:) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]}
segayrakladmvgnykdvikvltessdfrdnslilllagslrnrvtsirnslksiksqe
eklrkekslnnefiqviedikrdfeesillesedviriiddnllmyseegarafciklkg
dlmrykaeilkdeeknqcikqavefyedalqrersflekypsdplylatilnytilkydl
lgnpegamkfanraiqaaensrsdseqfsentekllkilrdnvsqweqgc

Sequence, based on observed residues (ATOM records): (download)

>d2ijpb_ a.118.7.1 (B:) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]}
segayrakladmvgnykdvikvltessdfrslilllagslrnrvtsirnslksiksqeek
lrkekslnnefiqviedikrdfeesillesedviriiddnllmyseegarafciklkgdl
mrykaeilkdeeknqcikqavefyedalqrersflekypsdplylatilnytilkydllg
npegamkfanraiqaaensrsdseqfsentekllkilrdnvsqweqgc

SCOPe Domain Coordinates for d2ijpb_:

Click to download the PDB-style file with coordinates for d2ijpb_.
(The format of our PDB-style files is described here.)

Timeline for d2ijpb_:

  • d2ijpb_ is new in SCOPe 2.06-stable