SCOPe 2.06: Domain d2iacb_: 2iac B:

Lineage for d2iacb_ (2iac B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)

6. Protein PTS system, IIA subunit [159616] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [159617] (2 PDB entries)
   Uniprot Q838I6 1-132

8. Domain d2iacb_: 2iac B: [304061]
   automated match to d3beda1

Details for d2iacb_

PDB Entry: 2iac, 1.45 Å

PDB Description: Mannose/sorbose specific IIA subunit of phosphotransferase system from Enterococcus faecalis.

PDB Compounds: (B:) PTS system, IIA component

SCOPe Domain Sequences for d2iacb_:

Sequence; same for both SEQRES and ATOM records:

>d2iacb_ c.54.1.1 (B:) PTS system, IIA subunit {Enterococcus faecalis [TaxId: 1351]}
mkpklilmshgrmaeetlastqmivgeladaaivsmtaedglsgtqaklaailkeagnvp
tlvladlkggtpcnvammamgtypqlrvvaglnlamaieaavspvenvdelaayltqigq
savttidlp

Timeline for d2iacb_:

• d2iacb_ is new in SCOPe 2.06-stable
  
• d2iacb_ appears in SCOPe 2.07
  
• d2iacb_ appears in the current release, SCOPe 2.08