Lineage for d1b5qc1 (1b5q C:5-293,C:406-466)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1351449Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1351450Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1351504Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1351745Protein Polyamine oxidase [51927] (1 species)
  7. 1351746Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries)
  8. 1351749Domain d1b5qc1: 1b5q C:5-293,C:406-466 [30406]
    Other proteins in same PDB: d1b5qa2, d1b5qb2, d1b5qc2
    complexed with fad, md2, nag

Details for d1b5qc1

PDB Entry: 1b5q (more details), 1.9 Å

PDB Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase
PDB Compounds: (C:) protein (polyamine oxidase)

SCOPe Domain Sequences for d1b5qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b5qc1 c.3.1.2 (C:5-293,C:406-466) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey
dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh

SCOPe Domain Coordinates for d1b5qc1:

Click to download the PDB-style file with coordinates for d1b5qc1.
(The format of our PDB-style files is described here.)

Timeline for d1b5qc1: