Lineage for d2i8ga_ (2i8g A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574956Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
    (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654
  4. 2574957Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) (S)
  5. 2574982Family d.107.1.4: DIP2269-like [160627] (1 protein)
    Pfam PF09449; DUF2020
  6. 2574983Protein Hypothetical protein DIP2269 [160628] (1 species)
  7. 2574984Species Corynebacterium diphtheriae [TaxId:1717] [160629] (2 PDB entries)
    Uniprot Q6NEK4 2-148
  8. 2574985Domain d2i8ga_: 2i8g A: [304058]
    automated match to d3v7ba_
    complexed with edo

Details for d2i8ga_

PDB Entry: 2i8g (more details), 1.74 Å

PDB Description: Crystal Structure of Protein of Unknown Function DIP2269 from Corynebacterium diphtheriae
PDB Compounds: (A:) Hypothetical protein DIP2269

SCOPe Domain Sequences for d2i8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i8ga_ d.107.1.4 (A:) Hypothetical protein DIP2269 {Corynebacterium diphtheriae [TaxId: 1717]}
vhdsalpfdalpmppqgregfeecpyldsqwvadtngqrmtgqgvdtrfdtpacvfwsyp
eapqatvmvrhmpseeeairvvdwaapidttepaeepdgwsggragheegavyavqkgpv
avvvwsnqqqslkaelmakeaiarlgl

SCOPe Domain Coordinates for d2i8ga_:

Click to download the PDB-style file with coordinates for d2i8ga_.
(The format of our PDB-style files is described here.)

Timeline for d2i8ga_: