| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily) (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654 |
Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) ![]() |
| Family d.107.1.4: DIP2269-like [160627] (1 protein) Pfam PF09449; DUF2020 |
| Protein Hypothetical protein DIP2269 [160628] (1 species) |
| Species Corynebacterium diphtheriae [TaxId:1717] [160629] (2 PDB entries) Uniprot Q6NEK4 2-148 |
| Domain d2i8ga_: 2i8g A: [304058] automated match to d3v7ba_ complexed with edo |
PDB Entry: 2i8g (more details), 1.74 Å
SCOPe Domain Sequences for d2i8ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i8ga_ d.107.1.4 (A:) Hypothetical protein DIP2269 {Corynebacterium diphtheriae [TaxId: 1717]}
vhdsalpfdalpmppqgregfeecpyldsqwvadtngqrmtgqgvdtrfdtpacvfwsyp
eapqatvmvrhmpseeeairvvdwaapidttepaeepdgwsggragheegavyavqkgpv
avvvwsnqqqslkaelmakeaiarlgl
Timeline for d2i8ga_: