SCOPe 2.08: Domain d2i8ga_: 2i8g A:

Lineage for d2i8ga_ (2i8g A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
   (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654

4. Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families)

5. Family d.107.1.4: DIP2269-like [160627] (1 protein)
   Pfam PF09449; DUF2020

6. Protein Hypothetical protein DIP2269 [160628] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [160629] (2 PDB entries)
   Uniprot Q6NEK4 2-148

8. Domain d2i8ga_: 2i8g A: [304058]
   automated match to d3v7ba_
   complexed with edo

Details for d2i8ga_

PDB Entry: 2i8g, 1.74 Å

PDB Description: Crystal Structure of Protein of Unknown Function DIP2269 from Corynebacterium diphtheriae

PDB Compounds: (A:) Hypothetical protein DIP2269

SCOPe Domain Sequences for d2i8ga_:

Sequence; same for both SEQRES and ATOM records:

>d2i8ga_ d.107.1.4 (A:) Hypothetical protein DIP2269 {Corynebacterium diphtheriae [TaxId: 1717]}
vhdsalpfdalpmppqgregfeecpyldsqwvadtngqrmtgqgvdtrfdtpacvfwsyp
eapqatvmvrhmpseeeairvvdwaapidttepaeepdgwsggragheegavyavqkgpv
avvvwsnqqqslkaelmakeaiarlgl

Timeline for d2i8ga_:

• d2i8ga_ first appeared in SCOPe 2.06
  
• d2i8ga_ appears in SCOPe 2.07