Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) |
Protein Bicarbonate transporter CmpA [310784] (1 species) member of Pfam PF13379 |
Species Synechocystis sp. [TaxId:1143] [311040] (4 PDB entries) |
Domain d2i4ca_: 2i4c A: [304051] automated match to d2i4ba_ complexed with bct, ca |
PDB Entry: 2i4c (more details), 1.7 Å
SCOPe Domain Sequences for d2i4ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i4ca_ c.94.1.1 (A:) Bicarbonate transporter CmpA {Synechocystis sp. [TaxId: 1143]} pemmpetaniklgyipiveaapliiaqekgffakygmtgvevskqanwasardnvtigsq gggidggqwqmpmphlitegiitngnkvpmyvlaqlitqgngiavapmhegkgvnlditk aadyikgfnktngrkfkaahtfpnvnqdfwirywfaaggvdpdtdidllavppaetvqgm rngtmdafstgdpwpyrivtenigymagltaqiwpyhpeeylairadwvdknpkatkall kgimeaqqwiddpknrpevvqivsgrnyfnvpttilespfkgqytmgdgqpaiddfqkgp lywkdgignvsypykshdlwfltesirwgfhknaipdldtaqkiidkvnredlwreaate agftadipsstsrgvetffdgitfdpanpsaylqslaikkv
Timeline for d2i4ca_: