SCOPe 2.06: Domain d2i4ca_: 2i4c A:

Lineage for d2i4ca_ (2i4c A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Bicarbonate transporter CmpA [310784] (1 species)
   member of Pfam PF13379

7. Species Synechocystis sp. [TaxId:1143] [311040] (4 PDB entries)

8. Domain d2i4ca_: 2i4c A: [304051]
   automated match to d2i4ba_
   complexed with bct, ca

Details for d2i4ca_

PDB Entry: 2i4c, 1.7 Å

PDB Description: Crystal structure of Bicarbonate Transport Protein CmpA from Synechocystis sp. PCC 6803 in complex with bicarbonate and calcium

PDB Compounds: (A:) Bicarbonate transporter

SCOPe Domain Sequences for d2i4ca_:

Sequence; same for both SEQRES and ATOM records:

>d2i4ca_ c.94.1.1 (A:) Bicarbonate transporter CmpA {Synechocystis sp. [TaxId: 1143]}
pemmpetaniklgyipiveaapliiaqekgffakygmtgvevskqanwasardnvtigsq
gggidggqwqmpmphlitegiitngnkvpmyvlaqlitqgngiavapmhegkgvnlditk
aadyikgfnktngrkfkaahtfpnvnqdfwirywfaaggvdpdtdidllavppaetvqgm
rngtmdafstgdpwpyrivtenigymagltaqiwpyhpeeylairadwvdknpkatkall
kgimeaqqwiddpknrpevvqivsgrnyfnvpttilespfkgqytmgdgqpaiddfqkgp
lywkdgignvsypykshdlwfltesirwgfhknaipdldtaqkiidkvnredlwreaate
agftadipsstsrgvetffdgitfdpanpsaylqslaikkv

Timeline for d2i4ca_:

• d2i4ca_ is new in SCOPe 2.06-stable
  
• d2i4ca_ appears in SCOPe 2.07
  
• d2i4ca_ appears in the current release, SCOPe 2.08