SCOPe 2.07: Domain d2hy4a1: 2hy4 A:11-183

Lineage for d2hy4a1 (2hy4 A:11-183)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (202 PDB entries)

8. Domain d2hy4a1: 2hy4 A:11-183 [304044]
   Other proteins in same PDB: d2hy4a2
   automated match to d2hxsa_
   complexed with gnp, mg

Details for d2hy4a1

PDB Entry: 2hy4, 1.5 Å

PDB Description: Crystal Structure of Rab28 GTPase in the Active (GppNHp-bound) Form

PDB Compounds: (A:) Ras-related protein Rab-28

SCOPe Domain Sequences for d2hy4a1:

Sequence; same for both SEQRES and ATOM records:

>d2hy4a1 c.37.1.0 (A:11-183) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqlkivvlgdgasgktslttcfaqetfgkqykqtigldfflrritlpgnlnvtlqiwdig
gqtiggkmldkyiygaqgvllvyditnyqsfenledwytvvkkvseesetqplvalvgnk
idlehmrtikpekhlrfcqengfsshfvsaktgdsvflcfqkvaaeilgikln

Timeline for d2hy4a1:

• d2hy4a1 first appeared in SCOPe 2.06
  
• d2hy4a1 appears in the current release, SCOPe 2.08