![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.136: FinO-like [48656] (1 superfamily) 6 helices: irregular non-globular array; also contains two small beta-hairpins |
![]() | Superfamily a.136.1: FinO-like [48657] (1 family) ![]() |
![]() | Family a.136.1.1: FinO-like [48658] (2 proteins) |
![]() | Protein Hypothetical protein NMB1681 [158846] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [158847] (2 PDB entries) Uniprot Q9JY98 3-118 |
![]() | Domain d2hxje2: 2hxj E:1-116 [304041] Other proteins in same PDB: d2hxje3 automated match to d3mw6a_ complexed with edo |
PDB Entry: 2hxj (more details), 2.21 Å
SCOPe Domain Sequences for d2hxje2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxje2 a.136.1.1 (E:1-116) Hypothetical protein NMB1681 {Neisseria meningitidis [TaxId: 487]} mtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqyd aaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqal
Timeline for d2hxje2: