SCOPe 2.08: Domain d2hxje2: 2hxj E:1-116

Lineage for d2hxje2 (2hxj E:1-116)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.136: FinO-like [48656] (1 superfamily)
   6 helices: irregular non-globular array; also contains two small beta-hairpins

4. Superfamily a.136.1: FinO-like [48657] (1 family)

5. Family a.136.1.1: FinO-like [48658] (2 proteins)

6. Protein Hypothetical protein NMB1681 [158846] (1 species)

7. Species Neisseria meningitidis [TaxId:487] [158847] (2 PDB entries)
   Uniprot Q9JY98 3-118

8. Domain d2hxje2: 2hxj E:1-116 [304041]
   Other proteins in same PDB: d2hxje3
   automated match to d3mw6a_
   complexed with edo

Details for d2hxje2

PDB Entry: 2hxj, 2.21 Å

PDB Description: Crystal structure of a Protein of Unknown Function NMB1681 from Neisseria Meningitidis MC58, Possible Nucleic Acid Binding Protein

PDB Compounds: (E:) hypothetical protein

SCOPe Domain Sequences for d2hxje2:

Sequence; same for both SEQRES and ATOM records:

>d2hxje2 a.136.1.1 (E:1-116) Hypothetical protein NMB1681 {Neisseria meningitidis [TaxId: 487]}
mtqetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqyd
aaliarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqal

Timeline for d2hxje2:

• d2hxje2 first appeared in SCOPe 2.06
  
• d2hxje2 appears in SCOPe 2.07