![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.136: FinO-like [48656] (1 superfamily) 6 helices: irregular non-globular array; also contains two small beta-hairpins |
![]() | Superfamily a.136.1: FinO-like [48657] (1 family) ![]() |
![]() | Family a.136.1.1: FinO-like [48658] (2 proteins) |
![]() | Protein Hypothetical protein NMB1681 [158846] (1 species) |
![]() | Species Neisseria meningitidis [TaxId:487] [158847] (2 PDB entries) Uniprot Q9JY98 3-118 |
![]() | Domain d2hxja_: 2hxj A: [304037] Other proteins in same PDB: d2hxje3 automated match to d3mw6a_ complexed with edo |
PDB Entry: 2hxj (more details), 2.21 Å
SCOPe Domain Sequences for d2hxja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxja_ a.136.1.1 (A:) Hypothetical protein NMB1681 {Neisseria meningitidis [TaxId: 487]} qetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaa liarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalqq
Timeline for d2hxja_: