Lineage for d2hxja_ (2hxj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733624Fold a.136: FinO-like [48656] (1 superfamily)
    6 helices: irregular non-globular array; also contains two small beta-hairpins
  4. 2733625Superfamily a.136.1: FinO-like [48657] (1 family) (S)
  5. 2733626Family a.136.1.1: FinO-like [48658] (2 proteins)
  6. 2733627Protein Hypothetical protein NMB1681 [158846] (1 species)
  7. 2733628Species Neisseria meningitidis [TaxId:487] [158847] (2 PDB entries)
    Uniprot Q9JY98 3-118
  8. 2733635Domain d2hxja_: 2hxj A: [304037]
    Other proteins in same PDB: d2hxje3
    automated match to d3mw6a_
    complexed with edo

Details for d2hxja_

PDB Entry: 2hxj (more details), 2.21 Å

PDB Description: Crystal structure of a Protein of Unknown Function NMB1681 from Neisseria Meningitidis MC58, Possible Nucleic Acid Binding Protein
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2hxja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxja_ a.136.1.1 (A:) Hypothetical protein NMB1681 {Neisseria meningitidis [TaxId: 487]}
qetalgaalksavqtmskkkqtemiadhiygkydvfkrfkplalgidqdliaalpqydaa
liarvlanhcrrprylkalarggkrfdlnnrfkgevtpeeqaiaqnhpfvqqalqq

SCOPe Domain Coordinates for d2hxja_:

Click to download the PDB-style file with coordinates for d2hxja_.
(The format of our PDB-style files is described here.)

Timeline for d2hxja_: