Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries) |
Domain d2hv0a_: 2hv0 A: [304034] automated match to d3cxpa_ complexed with 16g, coa |
PDB Entry: 2hv0 (more details), 1.8 Å
SCOPe Domain Sequences for d2hv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hv0a_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlte tgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrvedv vvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrrf lk
Timeline for d2hv0a_: