Lineage for d2hv0a_ (2hv0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969076Species Human (Homo sapiens) [TaxId:9606] [225745] (65 PDB entries)
  8. 2969101Domain d2hv0a_: 2hv0 A: [304034]
    automated match to d3cxpa_
    complexed with 16g, coa

Details for d2hv0a_

PDB Entry: 2hv0 (more details), 1.8 Å

PDB Description: Crystal structure of GNPNAT1
PDB Compounds: (A:) Glucosamine 6-phosphate N-acetyltransferase

SCOPe Domain Sequences for d2hv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hv0a_ d.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdetpmfdpsllkevdwsqntatfspaispthpgeglvlrplctadlnrgffkvlgqlte
tgvvspeqfmksfehmkksgdyyvtvvedvtlgqivatatliiehkfihscakrgrvedv
vvsdecrgkqlgklllstltllskklncykitleclpqnvgfykkfgytvseenymcrrf
lk

SCOPe Domain Coordinates for d2hv0a_:

Click to download the PDB-style file with coordinates for d2hv0a_.
(The format of our PDB-style files is described here.)

Timeline for d2hv0a_: