Lineage for d2hl0a_ (2hl0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920866Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins)
    Pfam PF08915
  6. 2920867Protein Threonyl-tRNA synthetase [310827] (1 species)
  7. 2920868Species Pyrococcus abyssi [TaxId:29292] [311096] (4 PDB entries)
  8. 2920869Domain d2hl0a_: 2hl0 A: [304023]
    automated match to d1y2qa_
    protein/RNA complex; complexed with a3s

Details for d2hl0a_

PDB Entry: 2hl0 (more details), 1.86 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with seryl-3'-aminoadenosine
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d2hl0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hl0a_ c.110.1.2 (A:) Threonyl-tRNA synthetase {Pyrococcus abyssi [TaxId: 29292]}
mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
kafkisckghplaelsrtivpee

SCOPe Domain Coordinates for d2hl0a_:

Click to download the PDB-style file with coordinates for d2hl0a_.
(The format of our PDB-style files is described here.)

Timeline for d2hl0a_: