SCOPe 2.06: Domain d2hktd1: 2hkt D:1-168

Lineage for d2hktd1 (2hkt D:1-168)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.285: MtlR-like [158667] (1 superfamily)
   multihelical; 8-helical up-and-down bundle

4. Superfamily a.285.1: MtlR-like [158668] (1 family)
   automatically mapped to Pfam PF05068

5. Family a.285.1.1: MtlR-like [158669] (2 proteins)
   Pfam PF05068; mannitol repressor

6. Protein Putative transcriptional regulator YggD [158670] (1 species)

7. Species Shigella flexneri [TaxId:623] [158671] (2 PDB entries)
   Uniprot Q83Q96 1-168! Uniprot Q83Q96 2-168! Uniprot Q83Q96 3-168

8. Domain d2hktd1: 2hkt D:1-168 [304020]
   Other proteins in same PDB: d2hktd2
   automated match to d3c8ga1
   complexed with edo

Details for d2hktd1

PDB Entry: 2hkt, 2.5 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator yggD from Shigella flexneri 2a str. 2457T

PDB Compounds: (D:) Putative transcriptional regulator

SCOPe Domain Sequences for d2hktd1:

Sequence, based on SEQRES records:

>d2hktd1 a.285.1.1 (D:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadfavwsearfsgmvktaltlavtttlkelt

Sequence, based on observed residues (ATOM records):

>d2hktd1 a.285.1.1 (D:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadwsearfsgmvktaltlavtttlkelt

Timeline for d2hktd1:

• d2hktd1 is new in SCOPe 2.06-stable
  
• d2hktd1 appears in SCOPe 2.07
  
• d2hktd1 appears in the current release, SCOPe 2.08