Lineage for d2hktd1 (2hkt D:1-168)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739181Fold a.285: MtlR-like [158667] (1 superfamily)
    multihelical; 8-helical up-and-down bundle
  4. 2739182Superfamily a.285.1: MtlR-like [158668] (1 family) (S)
    automatically mapped to Pfam PF05068
  5. 2739183Family a.285.1.1: MtlR-like [158669] (2 proteins)
    Pfam PF05068; mannitol repressor
  6. 2739190Protein Putative transcriptional regulator YggD [158670] (1 species)
  7. 2739191Species Shigella flexneri [TaxId:623] [158671] (2 PDB entries)
    Uniprot Q83Q96 1-168! Uniprot Q83Q96 2-168! Uniprot Q83Q96 3-168
  8. 2739195Domain d2hktd1: 2hkt D:1-168 [304020]
    Other proteins in same PDB: d2hktd2
    automated match to d3c8ga1
    complexed with edo

Details for d2hktd1

PDB Entry: 2hkt (more details), 2.5 Å

PDB Description: Structural Genomics, the crystal structure of a putative transcriptional regulator yggD from Shigella flexneri 2a str. 2457T
PDB Compounds: (D:) Putative transcriptional regulator

SCOPe Domain Sequences for d2hktd1:

Sequence, based on SEQRES records: (download)

>d2hktd1 a.285.1.1 (D:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadfavwsearfsgmvktaltlavtttlkelt

Sequence, based on observed residues (ATOM records): (download)

>d2hktd1 a.285.1.1 (D:1-168) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]}
matlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaq
sgplddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvn
sitrnatlydalkamkfadwsearfsgmvktaltlavtttlkelt

SCOPe Domain Coordinates for d2hktd1:

Click to download the PDB-style file with coordinates for d2hktd1.
(The format of our PDB-style files is described here.)

Timeline for d2hktd1: