![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.285: MtlR-like [158667] (1 superfamily) multihelical; 8-helical up-and-down bundle |
![]() | Superfamily a.285.1: MtlR-like [158668] (1 family) ![]() automatically mapped to Pfam PF05068 |
![]() | Family a.285.1.1: MtlR-like [158669] (2 proteins) Pfam PF05068; mannitol repressor |
![]() | Protein Putative transcriptional regulator YggD [158670] (1 species) |
![]() | Species Shigella flexneri [TaxId:623] [158671] (2 PDB entries) Uniprot Q83Q96 1-168! Uniprot Q83Q96 2-168! Uniprot Q83Q96 3-168 |
![]() | Domain d2hktb_: 2hkt B: [304018] Other proteins in same PDB: d2hktd2 automated match to d3c8gb1 complexed with edo |
PDB Entry: 2hkt (more details), 2.5 Å
SCOPe Domain Sequences for d2hktb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hktb_ a.285.1.1 (B:) Putative transcriptional regulator YggD {Shigella flexneri [TaxId: 623]} tlteddvleqldaqdnlfsfmktahsillqgirqflpslfvdndeeiveyavkpllaqsg plddidvalrliyalgkmdkwlyadithfsqywhylneqdetpgfadditwdfisnvnsi trnatlydalkamkfadfavwsearfsgmvktaltlavtttlkelt
Timeline for d2hktb_:
![]() Domains from other chains: (mouse over for more information) d2hkta_, d2hktc_, d2hktd1, d2hktd2 |