Lineage for d1h84a1 (1h84 A:5-293,A:406-463)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096770Protein Polyamine oxidase [51927] (1 species)
  7. 2096771Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries)
  8. 2096790Domain d1h84a1: 1h84 A:5-293,A:406-463 [30401]
    Other proteins in same PDB: d1h84a2, d1h84b2, d1h84c2
    complexed with fad, nag, nba

Details for d1h84a1

PDB Entry: 1h84 (more details), 2 Å

PDB Description: covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 4.6
PDB Compounds: (A:) polyamine oxidase

SCOPe Domain Sequences for d1h84a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h84a1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey
dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmc

SCOPe Domain Coordinates for d1h84a1:

Click to download the PDB-style file with coordinates for d1h84a1.
(The format of our PDB-style files is described here.)

Timeline for d1h84a1: