![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.390: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310562] (1 superfamily) beta-alpha(2)-beta-alpha-beta; 2 layers; order 123 |
![]() | Superfamily d.390.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310590] (1 family) ![]() Pfam PF16197 |
![]() | Family d.390.1.1: KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS)-like [310637] (2 proteins) |
![]() | Protein KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS) [310769] (1 species) |
![]() | Species Saccharopolyspora erythraea [TaxId:1836] [311025] (1 PDB entry) |
![]() | Domain d2hg4c4: 2hg4 C:466-549 [303986] Other proteins in same PDB: d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c2, d2hg4c3, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f5, d2hg4f6, d2hg4f7 complexed with act, cl, so4 |
PDB Entry: 2hg4 (more details), 2.73 Å
SCOPe Domain Sequences for d2hg4c4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg4c4 d.390.1.1 (C:466-549) KS-to-AT linker domain from 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]} gpvplvlsgrdeqamraqagrladhlareprnslrdtgftlatrrsawehravvvgdrde alaglravadgriadrtatgqart
Timeline for d2hg4c4:
![]() Domains from other chains: (mouse over for more information) d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7 |