Lineage for d2hc6a_ (2hc6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956515Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2956516Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2956543Family d.60.1.4: SOUL heme-binding protein [143481] (2 proteins)
    Pfam PF04832
  6. 2956544Protein Heme-binding protein 1 [143482] (1 species)
    p22HBP
  7. 2956545Species Mouse (Mus musculus) [TaxId:10090] [143483] (3 PDB entries)
    Uniprot Q9R257 1-190! Uniprot Q9R257 7-190
  8. 2956547Domain d2hc6a_: 2hc6 A: [303964]
    automated match to d2hvaa1

Details for d2hc6a_

PDB Entry: 2hc6 (more details)

PDB Description: Solution structure of the haem-binding protein p22HBP
PDB Compounds: (A:) Heme-binding protein 1

SCOPe Domain Sequences for d2hc6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hc6a_ d.60.1.4 (A:) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]}
mlgmirnslfgsvetwpwqvlstggkedvsyeeraceggkfatvevtdkpvdealreamp
kimkyvggtndkgvgmgmtvpvsfavfpnedgslqkklkvwfripnqfqgsppapsdesv
kieeregitvystqfggyakeadyvahatqlrttlegtpatyqgdvyycagydppmkpyg
rrnevwlvka

SCOPe Domain Coordinates for d2hc6a_:

Click to download the PDB-style file with coordinates for d2hc6a_.
(The format of our PDB-style files is described here.)

Timeline for d2hc6a_: