![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily) duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12) |
![]() | Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) ![]() |
![]() | Family d.60.1.4: SOUL heme-binding protein [143481] (2 proteins) Pfam PF04832 |
![]() | Protein Heme-binding protein 1 [143482] (1 species) p22HBP |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [143483] (3 PDB entries) Uniprot Q9R257 1-190! Uniprot Q9R257 7-190 |
![]() | Domain d2hc6a_: 2hc6 A: [303964] automated match to d2hvaa1 |
PDB Entry: 2hc6 (more details)
SCOPe Domain Sequences for d2hc6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hc6a_ d.60.1.4 (A:) Heme-binding protein 1 {Mouse (Mus musculus) [TaxId: 10090]} mlgmirnslfgsvetwpwqvlstggkedvsyeeraceggkfatvevtdkpvdealreamp kimkyvggtndkgvgmgmtvpvsfavfpnedgslqkklkvwfripnqfqgsppapsdesv kieeregitvystqfggyakeadyvahatqlrttlegtpatyqgdvyycagydppmkpyg rrnevwlvka
Timeline for d2hc6a_: