SCOPe 2.08: Domain d2h78a2: 2h78 A:163-296

Lineage for d2h78a2 (2h78 A:163-296)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Pseudomonas aeruginosa [311213] (1 PDB entry)

8. Domain d2h78a2: 2h78 A:163-296 [303944]
   Other proteins in same PDB: d2h78a1
   automated match to d3obba1
   complexed with act, edo, peg, pg4

Details for d2h78a2

PDB Entry: 2h78, 2.2 Å

PDB Description: Structural Genomics, the crystal structure of a putative 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1

PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2h78a2:

Sequence; same for both SEQRES and ATOM records:

>d2h78a2 a.100.1.0 (A:163-296) automated matches {Pseudomonas aeruginosa}
pdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimrrssggnwalevynpw
pgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyae
rdfsvvqklfdptq

Timeline for d2h78a2:

• d2h78a2 first appeared in SCOPe 2.06
  
• d2h78a2 appears in SCOPe 2.07