Lineage for d2h78a2 (2h78 A:163-296)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721905Species Pseudomonas aeruginosa [311213] (1 PDB entry)
  8. 2721906Domain d2h78a2: 2h78 A:163-296 [303944]
    Other proteins in same PDB: d2h78a1
    automated match to d3obba1
    complexed with act, edo, peg, pg4

Details for d2h78a2

PDB Entry: 2h78 (more details), 2.2 Å

PDB Description: Structural Genomics, the crystal structure of a putative 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1
PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d2h78a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h78a2 a.100.1.0 (A:163-296) automated matches {Pseudomonas aeruginosa}
pdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimrrssggnwalevynpw
pgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlllkqgyae
rdfsvvqklfdptq

SCOPe Domain Coordinates for d2h78a2:

Click to download the PDB-style file with coordinates for d2h78a2.
(The format of our PDB-style files is described here.)

Timeline for d2h78a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h78a1