Lineage for d2h33a1 (2h33 A:3-134)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332890Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2332891Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2332952Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2332953Protein automated matches [190464] (3 species)
    not a true protein
  7. 2332962Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2333011Domain d2h33a1: 2h33 A:3-134 [303938]
    Other proteins in same PDB: d2h33a2
    automated match to d2owia_

Details for d2h33a1

PDB Entry: 2h33 (more details)

PDB Description: The Structure of regulator of G-Protein signalling 18 (RGS18) (CASP target)
PDB Compounds: (A:) Regulator of G-protein signaling 18

SCOPe Domain Sequences for d2h33a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h33a1 a.91.1.0 (A:3-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlk
akaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflk
sdiyldlmegrp

SCOPe Domain Coordinates for d2h33a1:

Click to download the PDB-style file with coordinates for d2h33a1.
(The format of our PDB-style files is described here.)

Timeline for d2h33a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h33a2