SCOPe 2.06: Domain d2h33a1: 2h33 A:3-134

Lineage for d2h33a1 (2h33 A:3-134)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (30 PDB entries)

8. Domain d2h33a1: 2h33 A:3-134 [303938]
   Other proteins in same PDB: d2h33a2
   automated match to d2owia_

Details for d2h33a1

PDB Entry: 2h33

PDB Description: The Structure of regulator of G-Protein signalling 18 (RGS18) (CASP target)

PDB Compounds: (A:) Regulator of G-protein signaling 18

SCOPe Domain Sequences for d2h33a1:

Sequence; same for both SEQRES and ATOM records:

>d2h33a1 a.91.1.0 (A:3-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlk
akaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflk
sdiyldlmegrp

Timeline for d2h33a1:

• d2h33a1 is new in SCOPe 2.06-stable
  
• d2h33a1 appears in SCOPe 2.07
  
• d2h33a1 appears in the current release, SCOPe 2.08