| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) ![]() |
| Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
| Protein automated matches [190464] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries) |
| Domain d2h33a1: 2h33 A:3-134 [303938] Other proteins in same PDB: d2h33a2 automated match to d2owia_ |
PDB Entry: 2h33 (more details)
SCOPe Domain Sequences for d2h33a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h33a1 a.91.1.0 (A:3-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgpqqihlk
akaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqdsytrflk
sdiyldlmegrp
Timeline for d2h33a1: