Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins) Pfam PF05995, CDO_I |
Protein automated matches [191276] (4 species) not a true protein |
Species Cupriavidus necator [TaxId:264198] [311211] (1 PDB entry) |
Domain d2gm6a_: 2gm6 A: [303930] automated match to d4tlfd_ complexed with edo, fe, so4 |
PDB Entry: 2gm6 (more details), 1.84 Å
SCOPe Domain Sequences for d2gm6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gm6a_ b.82.1.19 (A:) automated matches {Cupriavidus necator [TaxId: 264198]} slaplrefitglsalldeqpgearilreggallarlvarddwlpdafaqphpeyyqqmll hcdsaerfsivsfvwgpgqrtpihdhtvwgligmlrgaeysqpfvldgsgrpvlhgeptr lepghveavsptvgdihrvhnayddrvsisihvyganiggvrrsvyteagerkpfisgys npylpnpwdrsk
Timeline for d2gm6a_: