Lineage for d2gm6a_ (2gm6 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815005Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2815084Protein automated matches [191276] (4 species)
    not a true protein
  7. 2815102Species Cupriavidus necator [TaxId:264198] [311211] (1 PDB entry)
  8. 2815103Domain d2gm6a_: 2gm6 A: [303930]
    automated match to d4tlfd_
    complexed with edo, fe, so4

Details for d2gm6a_

PDB Entry: 2gm6 (more details), 1.84 Å

PDB Description: crystal structure of a putative cysteine dioxygenase type i (reut_b5045) from ralstonia eutropha jmp134 at 1.84 a resolution
PDB Compounds: (A:) Cysteine dioxygenase type I

SCOPe Domain Sequences for d2gm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gm6a_ b.82.1.19 (A:) automated matches {Cupriavidus necator [TaxId: 264198]}
slaplrefitglsalldeqpgearilreggallarlvarddwlpdafaqphpeyyqqmll
hcdsaerfsivsfvwgpgqrtpihdhtvwgligmlrgaeysqpfvldgsgrpvlhgeptr
lepghveavsptvgdihrvhnayddrvsisihvyganiggvrrsvyteagerkpfisgys
npylpnpwdrsk

SCOPe Domain Coordinates for d2gm6a_:

Click to download the PDB-style file with coordinates for d2gm6a_.
(The format of our PDB-style files is described here.)

Timeline for d2gm6a_: