![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.5: AHSA1 domain [111168] (12 proteins) Pfam PF05146 |
![]() | Protein Calicheamicin gene cluster protein CalC [143831] (1 species) possible link between the AHSA1 (Pfam PF08327) and oligoketide cyclase/dehydrase-like (new Pfam PF03364) families |
![]() | Species Micromonospora echinospora [TaxId:1877] [143832] (4 PDB entries) Uniprot Q8KNF0 27-181 |
![]() | Domain d2gkca_: 2gkc A: [303929] automated match to d2l65a1 complexed with ccg |
PDB Entry: 2gkc (more details)
SCOPe Domain Sequences for d2gkca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gkca_ d.129.3.5 (A:) Calicheamicin gene cluster protein CalC {Micromonospora echinospora [TaxId: 1877]} nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr mgtkhakrvrngmdkgwptilqsfqdkideegakk
Timeline for d2gkca_: