Lineage for d2gjcb_ (2gjc B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2097329Family c.3.1.6: Thi4-like [141942] (2 protein domains)
    Pfam PF01946; stand-alone, moderately decorated domain
  6. 2097337Protein automated matches [310852] (2 species)
    not a true protein
  7. 2097338Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311210] (1 PDB entry)
  8. 2097340Domain d2gjcb_: 2gjc B: [303928]
    automated match to d3fpza_
    complexed with ahz

Details for d2gjcb_

PDB Entry: 2gjc (more details), 1.82 Å

PDB Description: Crystal Structure of Thiazole Synthase in Saccharomyces cerevisiae at 1.82 A resolution
PDB Compounds: (B:) Thiazole biosynthetic enzyme, mitochondrial

SCOPe Domain Sequences for d2gjcb_:

Sequence, based on SEQRES records: (download)

>d2gjcb_ c.3.1.6 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lhlnstpvthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgag
ssglsaayviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipye
degdyvvvkhaalfistvlskvlqlpnvklfnatcvedlvtrpptekgevtvagvvtnwt
lvtqahgtqccmdpnvielagykndgtrdlsqkhgvilsttghdgpfgafcakrivdidq
nqklggmkgldmnhaehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgv
haaeqilkhfaa

Sequence, based on observed residues (ATOM records): (download)

>d2gjcb_ c.3.1.6 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lhlnstpvthclsdivkkedwsdfkfapirestvsramtsryfkdldkfavsdviivgag
ssglsaayviaknrpdlkvciiessvapgggswlggqlfsamvmrkpahlflqeleipye
degdyvvvkhaalfistvlskvlqlpnvklfnatcvedlvtrppvtvagvvtnwtlvtqq
ccmdpnvielagykndgtrdlsqkhgvilsttghgafcakrivdidqnqklggmkgldmn
haehdvvihsgayagvdnmyfagmevaeldglnrmgptfgamalsgvhaaeqilkhfaa

SCOPe Domain Coordinates for d2gjcb_:

Click to download the PDB-style file with coordinates for d2gjcb_.
(The format of our PDB-style files is described here.)

Timeline for d2gjcb_:

  • d2gjcb_ is new in SCOPe 2.06-stable