SCOPe 2.07: Domain d2g1ib3: 2g1i B:361-554

Lineage for d2g1ib3 (2g1i B:361-554)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255610] (3 PDB entries)

8. Domain d2g1ib3: 2g1i B:361-554 [303913]
   Other proteins in same PDB: d2g1ia2, d2g1ib2, d2g1ic2, d2g1id2
   automated match to d2vk4a3
   complexed with mg, tpp

Details for d2g1ib3

PDB Entry: 2g1i, 2.26 Å

PDB Description: Crystal Structure of Pyruvate Decarboxylase from Kluyveromyces lactis

PDB Compounds: (B:) pyruvate decarboxylase

SCOPe Domain Sequences for d2g1ib3:

Sequence; same for both SEQRES and ATOM records:

>d2g1ib3 c.36.1.0 (B:361-554) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
ptmdapsnlvkqaq

Timeline for d2g1ib3:

• d2g1ib3 first appeared in SCOPe 2.06
  
• d2g1ib3 appears in the current release, SCOPe 2.08