| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
| Protein Polyamine oxidase [51927] (1 species) |
| Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries) |
| Domain d1b37c1: 1b37 C:5-293,C:406-466 [30391] Other proteins in same PDB: d1b37a2, d1b37b2, d1b37c2 complexed with fad |
PDB Entry: 1b37 (more details), 1.9 Å
SCOPe Domain Sequences for d1b37c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b37c1 c.3.1.2 (C:5-293,C:406-466) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey
dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh
Timeline for d1b37c1:
View in 3DDomains from other chains: (mouse over for more information) d1b37a1, d1b37a2, d1b37b1, d1b37b2 |