SCOPe 2.08: Domain d2fyqa_: 2fyq A:

Lineage for d2fyqa_ (2fyq A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Norwalk-like virus processing protease [310746] (2 species)
   Pfam PF05416; 3C-like according to PubMed 16227288

7. Species Norwalk virus [TaxId:11983] [311000] (2 PDB entries)

8. Domain d2fyqa_: 2fyq A: [303902]
   complexed with cl, po4
   fragment; missing more than one-third of the common structure and/or sequence

Details for d2fyqa_

PDB Entry: 2fyq, 1.5 Å

PDB Description: Crystal Structure of the Norwalk Virus Protease

PDB Compounds: (A:) Chymotrypsin-like cysteine proteinase

SCOPe Domain Sequences for d2fyqa_:

Sequence, based on SEQRES records:

>d2fyqa_ b.47.1.4 (A:) Norwalk-like virus processing protease {Norwalk virus [TaxId: 11983]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetal
e

Sequence, based on observed residues (ATOM records):

>d2fyqa_ b.47.1.4 (A:) Norwalk-like virus processing protease {Norwalk virus [TaxId: 11983]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqagegetale

Timeline for d2fyqa_:

• d2fyqa_ first appeared in SCOPe 2.06
  
• d2fyqa_ appears in SCOPe 2.07