![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
![]() | Protein U6 snRNA-associated sm-like protein LSM5 [141291] (1 species) |
![]() | Species Cryptosporidium parvum [TaxId:5807] [141292] (2 PDB entries) Uniprot Q5CXX3 24-115 |
![]() | Domain d2fwkb_: 2fwk B: [303901] automated match to d3pgga_ |
PDB Entry: 2fwk (more details), 2.14 Å
SCOPe Domain Sequences for d2fwkb_:
Sequence, based on SEQRES records: (download)
>d2fwkb_ b.38.1.1 (B:) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} iilplalidkcignriyvvmkgdkefsgvlrgfdeyvnmvlddvqeygfkadeedisggn kklkrvmvnrletillsgnnvamlvpgg
>d2fwkb_ b.38.1.1 (B:) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} iilplalidkcignriyvvmkgdkefsgvlrgfdeyvnmvlddvqeygvmvnrletills gnnvamlvpgg
Timeline for d2fwkb_: