SCOPe 2.01: Domain d1b37b1: 1b37 B:5-293,B:406-466

Lineage for d1b37b1 (1b37 B:5-293,B:406-466)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
   C-terminal domain is alpha+beta is common for the family

6. Protein Polyamine oxidase [51927] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries)

8. Domain d1b37b1: 1b37 B:5-293,B:406-466 [30390]
   Other proteins in same PDB: d1b37a2, d1b37b2, d1b37c2
   complexed with fad, nag

Details for d1b37b1

PDB Entry: 1b37, 1.9 Å

PDB Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase

PDB Compounds: (B:) protein (polyamine oxidase)

SCOPe Domain Sequences for d1b37b1:

Sequence; same for both SEQRES and ATOM records:

>d1b37b1 c.3.1.2 (B:5-293,B:406-466) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]}
prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey
dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh

Timeline for d1b37b1:

• d1b37b1 first appeared (with stable ids) in SCOP 1.55
  
• d1b37b1 appears in SCOP 1.75
  
• d1b37b1 appears in SCOPe 2.02
  
• d1b37b1 appears in the current release, SCOPe 2.08