Lineage for d1b37b1 (1b37 B:5-293,B:406-466)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20809Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 20880Protein Polyamine oxidase [51927] (1 species)
  7. 20881Species Maize (Zea mays) [TaxId:4577] [51928] (7 PDB entries)
  8. 20883Domain d1b37b1: 1b37 B:5-293,B:406-466 [30390]
    Other proteins in same PDB: d1b37a2, d1b37b2, d1b37c2

Details for d1b37b1

PDB Entry: 1b37 (more details), 1.9 Å

PDB Description: a 30 angstrom u-shaped catalytic tunnel in the crystal structure of polyamine oxidase

SCOP Domain Sequences for d1b37b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b37b1 c.3.1.2 (B:5-293,B:406-466) Polyamine oxidase {Maize (Zea mays)}
prvivvgagmsgisaakrlseagitdllileatdhiggrmhktnfaginvelganwvegv
nggkmnpiwpivnstlklrnfrsdfdylaqnvykedggvydedyvqkrieladsveemge
klsatlhasgrddmsilamqrlnehqpngpatpvdmvvdyykfdyefaepprvtslqntv
platfsdfgddvyfvadqrgyeavvyylagqylktddksgkivdprlqlnkvvreikysp
ggvtvktednsvysadyvmvsaslgvlqsdliqfkpklptwkvraiyqfXwpvgvnryey
dqlrapvgrvyftgehtsehyngyvhgaylsgidsaeilincaqkkmckyh

SCOP Domain Coordinates for d1b37b1:

Click to download the PDB-style file with coordinates for d1b37b1.
(The format of our PDB-style files is described here.)

Timeline for d1b37b1: