Lineage for d2frna_ (2frn A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130379Family c.66.1.47: Met-10+ protein-like [142622] (1 protein)
    Pfam PF02475; contains extra N-terminal alpha+beta domain: beta(2)-alpha-beta(2); mixed beta-sheet; order: 1234; cf (102740)
  6. 2130380Protein Hypothetical protein PH0793 [142623] (2 species)
  7. 2130381Species Pyrococcus horikoshii OT3 [TaxId:70601] [311208] (1 PDB entry)
  8. 2130382Domain d2frna_: 2frn A: [303886]
    automated match to d3k6ra_
    complexed with edo

Details for d2frna_

PDB Entry: 2frn (more details), 2.1 Å

PDB Description: Crystal structure of protein PH0793 from Pyrococcus horikoshii
PDB Compounds: (A:) hypothetical protein PH0793

SCOPe Domain Sequences for d2frna_:

Sequence, based on SEQRES records: (download)

>d2frna_ c.66.1.47 (A:) Hypothetical protein PH0793 {Pyrococcus horikoshii OT3 [TaxId: 70601]}
peelvkllpkrwvrigdvlllplrpelepykhriaevyaevlgvktvlrkghihgetrkp
dyellygsdtvtvhvengikykldvakimfspanvkervrmakvakpdelvvdmfagigh
lslpiavygkakviaiekdpytfkflvenihlnkvedrmsaynmdnrdfpgeniadrilm
gyvvrthefipkalsiakdgaiihyhntvpeklmprepfetfkritkeygydveklnelk
ikryapgvwhvvldlrvfks

Sequence, based on observed residues (ATOM records): (download)

>d2frna_ c.66.1.47 (A:) Hypothetical protein PH0793 {Pyrococcus horikoshii OT3 [TaxId: 70601]}
peelvkllpkrwvrigdvlllppelepykhriaevyaevlgvktvlrkgyellygsdtvt
vhvengikykldvakimfspanvkervrmakvakpdelvvdmfagighlslpiavygkak
viaiekdpytfkflvenihlnkvedrmsaynmdnrdfpgeniadrilmgyvvrthefipk
alsiakdgaiihyhntvpeklmprepfetfkritkeygydveklnelkikryapgvwhvv
ldlrvfks

SCOPe Domain Coordinates for d2frna_:

Click to download the PDB-style file with coordinates for d2frna_.
(The format of our PDB-style files is described here.)

Timeline for d2frna_:

  • d2frna_ is new in SCOPe 2.06-stable