Lineage for d2frmd4 (2frm D:165-327)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232537Protein Lactate dehydrogenase [56339] (19 species)
  7. 2232567Species Cryptosporidium parvum [TaxId:5807] [225186] (10 PDB entries)
  8. 2232585Domain d2frmd4: 2frm D:165-327 [303885]
    Other proteins in same PDB: d2frma3, d2frmb3, d2frmc3, d2frmd3
    automated match to d4nd1a2

Details for d2frmd4

PDB Entry: 2frm (more details), 2.1 Å

PDB Description: Crystal structure of the lactate dehydrogenase from cryptosporidium parvum
PDB Compounds: (D:) lactate dehydrogenase

SCOPe Domain Sequences for d2frmd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frmd4 d.162.1.1 (D:165-327) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntisk

SCOPe Domain Coordinates for d2frmd4:

Click to download the PDB-style file with coordinates for d2frmd4.
(The format of our PDB-style files is described here.)

Timeline for d2frmd4: