Lineage for d1gpeb1 (1gpe B:1-328,B:525-587)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688749Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 688778Protein Glucose oxidase [51924] (2 species)
  7. 688782Species Penicillium amagasakiense [TaxId:63559] [51926] (1 PDB entry)
  8. 688784Domain d1gpeb1: 1gpe B:1-328,B:525-587 [30388]
    Other proteins in same PDB: d1gpea2, d1gpeb2
    complexed with fad, man, nag

Details for d1gpeb1

PDB Entry: 1gpe (more details), 1.8 Å

PDB Description: glucose oxidase from penicillium amagasakiense
PDB Compounds: (B:) protein (glucose oxidase)

SCOP Domain Sequences for d1gpeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpeb1 c.3.1.2 (B:1-328,B:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]}
ylpaqqidvqssllsdpskvagktydyiiagggltgltvaakltenpkikvlviekgfye
sndgaiiedpnaygqifgttvdqnyltvplinnrtnnikagkglggstlingdswtrpdk
vqidswekvfgmegwnwdnmfeymkkaeaartptaaqlaaghsfnatchgtngtvqsgar
dngqpwspimkalmntvsalgvpvqqdflcghprgvsmimnnldenqvrvdaarawllpn
yqrsnleiltgqmvgkvlfkqtasgpqavgvnfgtnkavnfdvfakhevllaagsaispl
ileysgiglksvldqanvtqlldlpvgiXcsmmsrelggvvdatakvygtqglrvidgsi
pptqvsshvmtifygmalkvadailddyaksa

SCOP Domain Coordinates for d1gpeb1:

Click to download the PDB-style file with coordinates for d1gpeb1.
(The format of our PDB-style files is described here.)

Timeline for d1gpeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpeb2