| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (19 species) |
| Species Cryptosporidium parvum [TaxId:5807] [225185] (10 PDB entries) |
| Domain d2fnzb3: 2fnz B:17-164 [303876] Other proteins in same PDB: d2fnza4, d2fnzb4 automated match to d4nd1a1 complexed with gol, nad, oxm, so4 |
PDB Entry: 2fnz (more details), 2.5 Å
SCOPe Domain Sequences for d2fnzb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnzb3 c.2.1.5 (B:17-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma
Timeline for d2fnzb3: