SCOPe 2.06: Domain d2fnyq_: 2fny Q:

Lineage for d2fnyq_ (2fny Q:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2fnyq_: 2fny Q: [303865]
   Other proteins in same PDB: d2fnyg_, d2fnyh_, d2fnyu_, d2fnyv_
   automated match to d1rypd_
   complexed with esy

Details for d2fnyq_

PDB Entry: 2fny, 3 Å

PDB Description: Homobelactosin C bound to the yeast 20S proteasome

PDB Compounds: (Q:) Proteasome component PRE6

SCOPe Domain Sequences for d2fnyq_:

Sequence; same for both SEQRES and ATOM records:

>d2fnyq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

Timeline for d2fnyq_:

• d2fnyq_ is new in SCOPe 2.06-stable
  
• d2fnyq_ appears in SCOPe 2.07
  
• d2fnyq_ appears in the current release, SCOPe 2.08