Lineage for d1gal_1 (1gal 3-324,521-583)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67095Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 67105Protein Glucose oxidase [51924] (2 species)
  7. 67106Species Aspergillus niger [51925] (2 PDB entries)
  8. 67108Domain d1gal_1: 1gal 3-324,521-583 [30386]
    Other proteins in same PDB: d1gal_2

Details for d1gal_1

PDB Entry: 1gal (more details), 2.3 Å

PDB Description: crystal structure of glucose oxidase from aspergillus niger: refined at 2.3 angstroms resolution

SCOP Domain Sequences for d1gal_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gal_1 c.3.1.2 (3-324,521-583) Glucose oxidase {Aspergillus niger}
gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
igmksileplgidtvvdlpvglXcsmmpkemggvvdnaarvygvqglrvidgsipptqms
shvmtvfyamalkisdailedyasmq

SCOP Domain Coordinates for d1gal_1:

Click to download the PDB-style file with coordinates for d1gal_1.
(The format of our PDB-style files is described here.)

Timeline for d1gal_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gal_2