Lineage for d1cf3a1 (1cf3 A:3-324,A:521-583)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67095Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (7 proteins)
  6. 67105Protein Glucose oxidase [51924] (2 species)
  7. 67106Species Aspergillus niger [51925] (2 PDB entries)
  8. 67107Domain d1cf3a1: 1cf3 A:3-324,A:521-583 [30385]
    Other proteins in same PDB: d1cf3a2

Details for d1cf3a1

PDB Entry: 1cf3 (more details), 1.9 Å

PDB Description: glucose oxidase from apergillus niger

SCOP Domain Sequences for d1cf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger}
gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
igmksileplgidtvvdlpvglXcsmmpkemggvvdnaarvygvqglrvidgsipptqms
shvmtvfyamalkisdailedyasmq

SCOP Domain Coordinates for d1cf3a1:

Click to download the PDB-style file with coordinates for d1cf3a1.
(The format of our PDB-style files is described here.)

Timeline for d1cf3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf3a2