Lineage for d1cf3a1 (1cf3 A:3-324,A:521-583)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849418Protein Glucose oxidase [51924] (2 species)
  7. 2849419Species Aspergillus niger [TaxId:5061] [51925] (4 PDB entries)
  8. 2849422Domain d1cf3a1: 1cf3 A:3-324,A:521-583 [30385]
    Other proteins in same PDB: d1cf3a2
    complexed with fad, nag

Details for d1cf3a1

PDB Entry: 1cf3 (more details), 1.9 Å

PDB Description: glucose oxidase from apergillus niger
PDB Compounds: (A:) protein (glucose oxidase)

SCOPe Domain Sequences for d1cf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]}
gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
igmksileplgidtvvdlpvglXcsmmpkemggvvdnaarvygvqglrvidgsipptqms
shvmtvfyamalkisdailedyasmq

SCOPe Domain Coordinates for d1cf3a1:

Click to download the PDB-style file with coordinates for d1cf3a1.
(The format of our PDB-style files is described here.)

Timeline for d1cf3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cf3a2