Lineage for d2fm3b4 (2fm3 B:165-333)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2556839Species Cryptosporidium parvum [TaxId:5807] [225186] (10 PDB entries)
  8. 2556845Domain d2fm3b4: 2fm3 B:165-333 [303847]
    Other proteins in same PDB: d2fm3a3, d2fm3b3
    automated match to d4nd1a2
    complexed with gol, nad, pyr

Details for d2fm3b4

PDB Entry: 2fm3 (more details), 2.2 Å

PDB Description: Crystal structure of the Lactate Dehydrogenase from Cryptosporidium parvum complexed with substrate (Pyruvic acid) and cofactor (b-Nicotinamide adenine dinucleotide)
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d2fm3b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm3b4 d.162.1.1 (B:165-333) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntiskvldnap

SCOPe Domain Coordinates for d2fm3b4:

Click to download the PDB-style file with coordinates for d2fm3b4.
(The format of our PDB-style files is described here.)

Timeline for d2fm3b4:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fm3b3