![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (3 PDB entries) |
![]() | Domain d2fjja_: 2fjj A: [303835] automated match to d2k3ka1 |
PDB Entry: 2fjj (more details)
SCOPe Domain Sequences for d2fjja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjja_ d.58.7.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig sasnalrtmqgfpfydkpmqiaysksdsdivakikgtfkerpkk
Timeline for d2fjja_: