Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein automated matches [190332] (5 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (4 PDB entries) |
Domain d2fjja_: 2fjj A: [303835] automated match to d2k3ka1 |
PDB Entry: 2fjj (more details)
SCOPe Domain Sequences for d2fjja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjja_ d.58.7.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig sasnalrtmqgfpfydkpmqiaysksdsdivakikgtfkerpkk
Timeline for d2fjja_: