Lineage for d2fjja_ (2fjj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952340Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [311207] (4 PDB entries)
  8. 2952349Domain d2fjja_: 2fjj A: [303835]
    automated match to d2k3ka1

Details for d2fjja_

PDB Entry: 2fjj (more details)

PDB Description: Solution Structure of Drosophila melanogaster SNF RBD1
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d2fjja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjja_ d.58.7.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
memlpnqtiyinnlnekikkeelkkslyaifsqfgqildivalktlkmrgqafvifkeig
sasnalrtmqgfpfydkpmqiaysksdsdivakikgtfkerpkk

SCOPe Domain Coordinates for d2fjja_:

Click to download the PDB-style file with coordinates for d2fjja_.
(The format of our PDB-style files is described here.)

Timeline for d2fjja_: