SCOPe 2.08: Domain d2fgdd2: 2fgd D:78-163

Lineage for d2fgdd2 (2fgd D:78-163)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.6: IlvH-like [143376] (2 proteins)
   Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes

6. Protein automated matches [310850] (1 species)
   not a true protein

7. Species Nitrosomonas europaea [311206] (1 PDB entry)

8. Domain d2fgdd2: 2fgd D:78-163 [303834]
   Other proteins in same PDB: d2fgda3
   automated match to d2pc6a1
   complexed with ca, sin

Details for d2fgdd2

PDB Entry: 2fgd, 2.5 Å

PDB Description: Crystal structure of putative acetolactate synthase-small subunit from Nitrosomonas europea

PDB Compounds: (D:) Probable acetolactate synthase isozyme III (Small subunit)

SCOPe Domain Sequences for d2fgdd2:

Sequence; same for both SEQRES and ATOM records:

>d2fgdd2 d.58.18.6 (D:78-163) automated matches {Nitrosomonas europaea}
segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa
vdcnlileiartgvsglsrgervlkl

Timeline for d2fgdd2:

• d2fgdd2 first appeared in SCOPe 2.06
  
• d2fgdd2 appears in SCOPe 2.07