Lineage for d2fgdc2 (2fgd C:78-163)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197025Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2197123Family d.58.18.6: IlvH-like [143376] (2 proteins)
    Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes
  6. 2197142Protein automated matches [310850] (1 species)
    not a true protein
  7. 2197143Species Nitrosomonas europaea [311206] (1 PDB entry)
  8. 2197149Domain d2fgdc2: 2fgd C:78-163 [303832]
    Other proteins in same PDB: d2fgda3
    automated match to d2pc6a1
    complexed with ca, sin

Details for d2fgdc2

PDB Entry: 2fgd (more details), 2.5 Å

PDB Description: Crystal structure of putative acetolactate synthase-small subunit from Nitrosomonas europea
PDB Compounds: (C:) Probable acetolactate synthase isozyme III (Small subunit)

SCOPe Domain Sequences for d2fgdc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgdc2 d.58.18.6 (C:78-163) automated matches {Nitrosomonas europaea}
segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa
vdcnlileiartgvsglsrgervlkl

SCOPe Domain Coordinates for d2fgdc2:

Click to download the PDB-style file with coordinates for d2fgdc2.
(The format of our PDB-style files is described here.)

Timeline for d2fgdc2: