![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (15 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.6: IlvH-like [143376] (2 proteins) Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes |
![]() | Protein automated matches [310850] (1 species) not a true protein |
![]() | Species Nitrosomonas europaea [311206] (1 PDB entry) |
![]() | Domain d2fgdc2: 2fgd C:78-163 [303832] Other proteins in same PDB: d2fgda3 automated match to d2pc6a1 complexed with ca, sin |
PDB Entry: 2fgd (more details), 2.5 Å
SCOPe Domain Sequences for d2fgdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgdc2 d.58.18.6 (C:78-163) automated matches {Nitrosomonas europaea} segyverelmlvkvravgkdreemkrladifrgniidvtnelytieltgtrskldgflqa vdcnlileiartgvsglsrgervlkl
Timeline for d2fgdc2: